PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G287000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 344aa    MW: 36397.6 Da    PI: 4.5782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G287000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-161663148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT++Ed +l  ++k++G  +W++ ++  g+ R++k+c++rw +yl
  Sevir.1G287000.1.p 16 RGSWTPQEDMRLMAYIKKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                        89******************************99************97 PP

2Myb_DNA-binding51.13e-1669114148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Sevir.1G287000.1.p  69 RGNFTVEEEETIIRLHGMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.4611163IPR017930Myb domain
SuperFamilySSF466899.9E-3013110IPR009057Homeodomain-like
SMARTSM007178.7E-121565IPR001005SANT/Myb domain
PfamPF002491.3E-141663IPR001005SANT/Myb domain
CDDcd001678.28E-101863No hitNo description
PROSITE profilePS5129424.89664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2667118IPR009057Homeodomain-like
SMARTSM007172.1E-1468116IPR001005SANT/Myb domain
PfamPF002491.1E-1469114IPR001005SANT/Myb domain
CDDcd001675.01E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLMAY IKKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETI IRLHGMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKKVAL  120
REQQKAGATS NGGAASGNDA GTPVTASSSA SSSTTTNNSS GGSDSGDQCG TSKEPDAVDV  180
PPLQLEDIDV SDMLVDAPTA AQPMLSSSCS SSSLTTCIGR GVEELIELPV IDIEPDIWSI  240
IDGECADASG ARHGDATAPC TGAAISTTSV AGEEAANDDW WLENLEKELG LWGPVGGPQD  300
HTGLGPLVDS ERDPVSTYFQ TGPSNAETEL LDVELEPSSA VLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141185108B-MYB
1mse_C1e-26141182105C-Myb DNA-Binding Domain
1msf_C1e-26141182105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794371e-174HF679437.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB31 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953532.10.0PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-165MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK3YTV80.0K3YTV8_SETIT; Uncharacterized protein
STRINGSi017704m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.14e-67myb domain protein 63